Ariete 4164 Steam mop 10 in 1 — уход и чистка бытовых приборов: советы и рекомендации [23/124]
![Ariete 4164 Steam mop 10 in 1 [23/124] Warning](/views2/1528582/page23/bg17.png)
CLEANING AND MAINTENANCE
Warning!
$OZD\VXQSOXJWKHDSSOLDQFHEHIRUHFOHDQLQJLW/HWWKHDSSOLDQFHWRFRROGRZQIRUDIHZ
minutes.
Warning!
Never immerse the appliance in water or other liquids.
Warning!
Check the state of the power cable of your appliance on a regular basis before using it, and if it
is damaged, take it to the service centre closest to you to have it replaced only by specialised
personnel.
Do not use abrasive products for cleaning the appliance.
'RQRWSRXUGHVFDOLQJSURGXFWVRURWKHUVFHQWHGVXEVWDQFHVLQWRWKHWDQN2WKHUZLVHWKH
warranty may be revoked.
Cleaning the appliance
To prevent lime residue from forming, empty the tank following use and after having turned off the
appliance and unplugged it from the socket-outlet.
Clean the water tank from time to time by putting fresh water in it. To remove limestone deposits
IURPWKHWDQNDGGDWDEOHVSRRQRIYLQHJDU5LQVHDQGHPSW\'RQRWWXUQRQWKHDSSOLDQFH
Clean plastic parts with a damp, non-abrasive cloth and dry them with a dry cloth.
)ROORZWKHLQVWUXFWLRQVRQWKHODEHOWRFOHDQWKHZDVKDEOHFORWK
Limestone cleaning
Damage caused by limescale is not covered by warranty.
$JRRGPDLQWHQDQFHDQGUHJXODUFOHDQLQJSUHVHUYHDQGPDLQWDLQWKHDSSOLDQFHHI¿FLHQWIRUDORQJHU
period greatly reducing the risk of scale formation. If despite this, after some time, the appliance
function should be compromised, due to constant use of hard and very hard water, it is possible to
carry out a descaling operation to eliminate the malfunction.
Perform the cleaning once every three months. If very hard water is used clean every month.
Warning!
Never leave the appliance unattended while in use.
Carry out the scale cleaning operation in a ventilated room. When cleaning the limescale, ap-
ply steam to a resistant surface or on a washable cloth. Do not breathe the vapours produced
during the descaling cleaning.
)LOOWKHWDQNZLWKDPL[WXUHRIZKLWHYLQHJDUDQGRIIUHVKFOHDQZDWHU
3RXUWKHPL[WXUHLQWKHWDQN
3ODFHWKHDSSOLDQFHVRWKDWWKHVWHDPLVQRWGLVSHQVHGRQDQ\REMHFWRUVXUIDFH
3OXJLQWRWKHPDLQVVRFNHWTurn the steam control knob (E). Leave the appliance into operation
IRUDWOHDVWRQHPLQXWH7XUQWKHVWHDPFRQWURONQRE(RQ0,1/HDYHRIIWKHDSSOLDQFHIRUD
PLQXWH5HSHDWXQWLOWKHUHOHDVHRIVWHDPLVQRWLFHGLet the all the steam come out until there
is no more solution in the tank. If necessary, repeat the operation.
23
EN
Содержание
- Odkurzacz parowy p.1
- Pulitore a vapore per pavimenti steam mop nettoyeuse à vapeur pour sols fußboden dampfreiniger limpiador de vapor para suelos vassoura elétrica a vapor stoomreiniger voor vloeren p.1
- ﺕﺎﻳﺿﺭﻸﻟ ﺭﺎﺧﺑﻟﺎﺑ ﻑﻳﻅﻧﺗ ﺔﺳﻧﻛﻣ p.1
- Avvertenze di sicurezza p.4
- Attenzione p.4
- Leggere attentamente le istruzioni prima dell uso p.4
- Conservare sempre queste istruzioni p.8
- Attenzione p.9
- Attenzione p.10
- Attenzione p.12
- Attenzione p.14
- Read these instructions carefully unsuitable for commercial or industrial purposes covered in this booklet service does not cover any damage resulting from inadequate packaging of the p.15
- Warning p.15
- Important safeguards p.15
- Warning p.19
- Warning p.20
- Warning p.21
- Warning p.23
- Warning p.24
- Attention p.25
- Lisez attentivement ces instructions p.25
- Conseils de sécurité p.25
- Conserver ces instructions p.29
- Attention p.30
- Attention p.31
- Attention p.33
- Attention p.35
- Wichtige hinweise p.36
- Die bedienungsanleitung vor dem gebrauch aufmerksam lesen p.36
- Che oder industrielle zwecke verwendet werden p.36
- Achtung p.36
- Sollten sie auch für kurze zeit die stelle verlassen wo das gerät betrieben wird das gerät immer ausschalten und immer das versorgungskabel aus der steckdose ziehen p.40
- Füllen von wasser stets den stecker des anschlusskabels aus der steckdose ziehen p.40
- Die bedienungsanleitung stets gut aufbewahren p.40
- Achtung p.41
- Achtung p.42
- Achtung p.44
- Achtung p.45
- Achtung p.46
- Leer atentamente estas instrucciones considerar inadecuado para uso comercial o industrial a los previstos en este manual de instrucciones p.47
- Atención p.47
- Advertencias importantes para la seguridad p.47
- Guardar siempre estas instrucciones p.51
- Atención p.52
- Atención p.53
- Atención p.55
- Atención p.57
- Ler cuidadosamente estas instruções p.58
- Atenção p.58
- Advertências importantes p.58
- Conservar estas instruções p.62
- Atenção p.63
- Atenção p.64
- Atenção p.66
- Atenção p.68
- Let op p.69
- Lees deze instructies aandachtig door p.69
- Belangrijke waarschuwingen p.69
- Bewaar deze instructies altijd p.73
- Let op p.74
- Let op p.75
- Let op p.77
- Let op p.79
- ﺔئمﺎﻘﻟا رﺎﻄﺧﻷا p.104
- ﺐ ﻴﺘﻜﻟا اﺬﻫ صﻮﺼﺨﺑ p.104
- لماﻌﺘﺳﻻا ﻞﺒﻗ تماﻴﻠﻌﺘﻟا صﺮﺤﺑ أﺮﻗا p.104
- زﺎﻬﺠﻟا ﻦﻣ ضﺮﻐﻟا p.104
- Ce mod sn p.107
- ﺔﻴﻨﻓ تﺎﻣﻮﻠﻌﻣ p.107
- زﺎﻬﺠﻟا ﻊﻴﻤﺠﺗ p.107
- تماﻴﻠﻌﺘﻟا هﺬﻬﺑ ﺎئماد ﻆﻔﺘﺣا زﺎﻬﺠﻟا تﺎﻔﺻاﻮﻣ p.107
- لماﻌﺘﺳﻻا تماﻴﻠﻌﺗ p.108
- لماﻌﺘﺳﻻا ءﺎﻨﺛأ ءﺎﳌﺎﺑ ناﺰﺨﻟا ﺊﻠﻣ p.108
- لماﻌﺘﺳﻻا ﺪﻌﺑ p.109
- تﺎﻘﺤﻠﳌا لماﻌﺘﺳا p.109
- تﺎﻃﺎﺴﺒﻟا ﻒﻴﻈﻨﺘﻟ ﻖﺤﻠﻣ p.109
- ﺔﻧﺎﻴﺼﻟاو ﻒﻴﻈﻨﺘﻟا p.110
- 9 ﺔﺠﺴﻧﻸﻟ ﻖﺤﻠﻣ p.110
- ﺔﻴﺴﻠﻜﻟا تﺎﺒﺳﱰﻟا ﻒﻴﻈﻨﺗ p.111
- ﺔﻨﻴﻛﺎﳌا ﻒﻴﻈﻨﺗ p.111
- ﻞﻛﺎﺸﳌا ﺾﻌﺑ ﻞﺤﻟ تادﺎﺷرإ p.112
- Nale y zapozna si uwa nie z instrukc przed u yciem p.114
Похожие устройства
-
Ariete 4146Руководство по эксплуатации -
Ariete 4147 Xsteam No Stop WhiteРуководство по эксплуатации -
Ariete 4137Инструкция по эксплуатации -
Ariete Steam and sweeper 4163/1Инструкция по эксплуатации -
Ariete 2706 STEAM AND SWEEPERИнструкция по эксплуатации -
Ariete 4147Руководство по эксплуатации -
Ariete 4146Руководство по эксплуатации -
Ariete 4145Руководство по эксплуатации -
Ariete 4207/1 MultiVapori MV7.20Инструкция по эксплуатации -
Ariete 4204 MultiVapori MV6.10Инструкция по эксплуатации -
Ariete Multivapori MV5.10 (4203)Инструкция по эксплуатации -
Ariete 4144Инструкция по эксплуатации
Узнайте, как правильно чистить и обслуживать бытовые приборы для продления их срока службы. Следуйте простым рекомендациям по уходу и предотвращению образования накипи.